PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g22780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NAC
Protein Properties Length: 433aa    MW: 48495.8 Da    PI: 9.1768
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g22780genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.63e-50291551128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                 + pGfrF+Ptdeel+++yLkkk+eg++  + evi+ev+i k+ePwdLp k+v ++++ew+fFs+r +ky++g++++rat+sgyWkatgk+++v+s +++
  CA06g22780  29 MFPGFRFSPTDEELISYYLKKKLEGSDKCV-EVISEVEIWKHEPWDLPaKSVIQSDNEWFFFSPRGRKYPNGSQSKRATESGYWKATGKERNVKS-SSN 125
                 579************************777.99***************667777899**************************************.999 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 ++g+k+tLvf++grapkg++t+W+mhey +
  CA06g22780 126 VIGTKRTLVFHTGRAPKGQRTQWIMHEYCM 155
                 ****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-5625172IPR003441NAC domain
PROSITE profilePS5100554.39929173IPR003441NAC domain
PfamPF023651.8E-2631154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009626Biological Processplant-type hypersensitive response
GO:0009910Biological Processnegative regulation of flower development
GO:0034976Biological Processresponse to endoplasmic reticulum stress
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MENGHVSTSS RNNNNNNNVE ISIATASSMF PGFRFSPTDE ELISYYLKKK LEGSDKCVEV  60
ISEVEIWKHE PWDLPAKSVI QSDNEWFFFS PRGRKYPNGS QSKRATESGY WKATGKERNV  120
KSSSNVIGTK RTLVFHTGRA PKGQRTQWIM HEYCMSGNTN YQDSMVVCRL RKNSEFHLND  180
TPRNQRNQLV ATDSATALSG AGQLGSLEFV NVGDCCSKEG SSSFRSHSVE QIDSGSESDR  240
PTKEFSQHDS SGHFQVLVLP PVSHTSRSFG PNILLCGFQD FDGEEDWFAD IMKDDIIELD  300
DSSLNARPIS MIPVRPESSE ISNHEAQAAM SSVVPFQGTA NRRLRLVRQV VTQCRVKGSK  360
PYKAIKMNKI GGGTTSSARW LSNMFSVKWM RQYVIPIFLV TLTLLVMLLS LLEVSQQVKP  420
RKRLLILASS RS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-45201738165NO APICAL MERISTEM PROTEIN
1ut4_B9e-45201738165NO APICAL MERISTEM PROTEIN
1ut7_A9e-45201738165NO APICAL MERISTEM PROTEIN
1ut7_B9e-45201738165NO APICAL MERISTEM PROTEIN
3swm_A1e-442017311168NAC domain-containing protein 19
3swm_B1e-442017311168NAC domain-containing protein 19
3swm_C1e-442017311168NAC domain-containing protein 19
3swm_D1e-442017311168NAC domain-containing protein 19
3swp_A1e-442017311168NAC domain-containing protein 19
3swp_B1e-442017311168NAC domain-containing protein 19
3swp_C1e-442017311168NAC domain-containing protein 19
3swp_D1e-442017311168NAC domain-containing protein 19
4dul_A9e-45201738165NAC domain-containing protein 19
4dul_B9e-45201738165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755181e-140HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016577960.10.0PREDICTED: NAC domain-containing protein 40-like
TrEMBLM1A5E50.0M1A5E5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000150770.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22290.13e-81NAC domain containing protein 89